Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily) 2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8 |
Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) |
Family e.17.1.0: automated matches [191499] (1 protein) not a true family |
Protein automated matches [190815] (21 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [188374] (4 PDB entries) |
Domain d2ej0b_: 2ej0 B: [164075] automated match to d1a3ga_ complexed with mpd, pmp |
PDB Entry: 2ej0 (more details), 1.6 Å
SCOPe Domain Sequences for d2ej0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ej0b_ e.17.1.0 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} qikagliwmngafvpqeeaktsvlshalhygtsvfegirayetakgpaifrlkehvkrfy nsakvlrmeipfapeeleeaikevvrrngyrscyirplawmgakalgvnplpnnpaevmv aawewgaylgeeavrkgarlitsswarfpanvmpgkakvggnyvnsalakmeavaagade allldeegyvaegsgenlffvrdgviyalehsvnlegitrdsviriakdlgyevqvvrat rdqlymadevfmtgtaaevtpvsmidwrpigkgtagpvalrlrevyleavtgrrpeyegw ltyvn
Timeline for d2ej0b_: