Lineage for d2eiyb_ (2eiy B:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1953348Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 1953349Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 1953446Family e.17.1.0: automated matches [191499] (1 protein)
    not a true family
  6. 1953447Protein automated matches [190815] (10 species)
    not a true protein
  7. 1953488Species Thermus thermophilus HB8 [TaxId:300852] [188374] (4 PDB entries)
  8. 1953490Domain d2eiyb_: 2eiy B: [164072]
    automated match to d1a3ga_
    complexed with 4mv, mpd, plp

Details for d2eiyb_

PDB Entry: 2eiy (more details), 1.35 Å

PDB Description: crystal structure of t.th.hb8 branched-chain amino acid aminotransferase complexed with 4-methylvaleric acid
PDB Compounds: (B:) branched-chain amino acid aminotransferase

SCOPe Domain Sequences for d2eiyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eiyb_ e.17.1.0 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
ikagliwmngafvpqeeaktsvlshalhygtsvfegirayetakgpaifrlkehvkrfyn
sakvlrmeipfapeeleeaikevvrrngyrscyirplawmgakalgvnplpnnpaevmva
awewgaylgeeavrkgarlitsswarfpanvmpgkakvggnyvnsalakmeavaagadea
llldeegyvaegsgenlffvrdgviyalehsvnlegitrdsviriakdlgyevqvvratr
dqlymadevfmtgtaaevtpvsmidwrpigkgtagpvalrlrevyleavtgrrpeyegwl
tyvn

SCOPe Domain Coordinates for d2eiyb_:

Click to download the PDB-style file with coordinates for d2eiyb_.
(The format of our PDB-style files is described here.)

Timeline for d2eiyb_: