Lineage for d2eiya_ (2eiy A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2573070Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 2573071Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 2573190Family e.17.1.0: automated matches [191499] (1 protein)
    not a true family
  6. 2573191Protein automated matches [190815] (19 species)
    not a true protein
  7. 2573258Species Thermus thermophilus HB8 [TaxId:300852] [188374] (4 PDB entries)
  8. 2573265Domain d2eiya_: 2eiy A: [164071]
    automated match to d1a3ga_
    complexed with 4mv, mpd, plp

Details for d2eiya_

PDB Entry: 2eiy (more details), 1.35 Å

PDB Description: crystal structure of t.th.hb8 branched-chain amino acid aminotransferase complexed with 4-methylvaleric acid
PDB Compounds: (A:) branched-chain amino acid aminotransferase

SCOPe Domain Sequences for d2eiya_:

Sequence, based on SEQRES records: (download)

>d2eiya_ e.17.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
qikagliwmngafvpqeeaktsvlshalhygtsvfegirayetakgpaifrlkehvkrfy
nsakvlrmeipfapeeleeaikevvrrngyrscyirplawmgakalgvnplpnnpaevmv
aawewgaylgeeavrkgarlitsswarfpanvmpgkakvggnyvnsalakmeavaagade
allldeegyvaegsgenlffvrdgviyalehsvnlegitrdsviriakdlgyevqvvrat
rdqlymadevfmtgtaaevtpvsmidwrpigkgtagpvalrlrevyleavtgrrpeyegw
ltyvn

Sequence, based on observed residues (ATOM records): (download)

>d2eiya_ e.17.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
qikagliwmngafvpqeeaktsvlshalhygtsvfegirayetakgpaifrlkehvkrfy
nsakvlrmeipfapeeleeaikevvrrngyrscyirplawmgakalgvnplpnnpaevmv
aawewvrkgarlitsswarfpanvmpgkakvggnyvnsalakmeavaagadeallldeeg
yvaegsgenlffvrdgviyalehsvnlegitrdsviriakdlgyevqvvratrdqlymad
evfmtgtaaevtpvsmidwrpigkgtagpvalrlrevyleavtgrrpeyegwltyvn

SCOPe Domain Coordinates for d2eiya_:

Click to download the PDB-style file with coordinates for d2eiya_.
(The format of our PDB-style files is described here.)

Timeline for d2eiya_: