SCOPe 2.05: Domain d2ehdb_: 2ehd B:

Lineage for d2ehdb_ (2ehd B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (203 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [187989] (16 PDB entries)

8. Domain d2ehdb_: 2ehd B: [164029]
   automated match to d2bd0a1
   complexed with co

Details for d2ehdb_

PDB Entry: 2ehd, 2.4 Å

PDB Description: Crystal Structure Analysis of Oxidoreductase

PDB Compounds: (B:) Oxidoreductase, short-chain dehydrogenase/reductase family

SCOPe Domain Sequences for d2ehdb_:

Sequence, based on SEQRES records:

>d2ehdb_ c.2.1.0 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
egmkgavlitgasrgigeatarllhakgyrvglmardekrlqalaaelegalplpgdvre
egdwaravaameeafgelsalvnnagvgvmkpvheltleewrlvldtnltgaflgirhav
pallrrgggtivnvgslagknpfkggaaynaskfgllglagaamldlreanvrvvnvlpg
svdtgfagntpgqawklkpedvaqavlfalempghamvseielrpt

Sequence, based on observed residues (ATOM records):

>d2ehdb_ c.2.1.0 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
egmkgavlitgasrgigeatarllhakgyrvglmardekrlqalaaelegalplpgdvre
egdwaravaameeafgelsalvnnagvgvmkpvheltleewrlvldtnltgaflgirhav
pallrrgggtivnvgslagknpfkggaaynaskfgllglagaamldlreanvrvvnvlpg
svklkpedvaqavlfalempghamvseielrpt

Timeline for d2ehdb_:

• d2ehdb_ first appeared in SCOPe 2.01
  
• d2ehdb_ appears in SCOPe 2.04
  
• d2ehdb_ appears in SCOPe 2.06
  
• d2ehdb_ appears in the current release, SCOPe 2.08