Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) |
Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
Protein automated matches [190143] (42 species) not a true protein |
Species Aquifex aeolicus [TaxId:63363] [187664] (3 PDB entries) |
Domain d2egig_: 2egi G: [164004] automated match to d1z54a1 complexed with gol |
PDB Entry: 2egi (more details), 2.3 Å
SCOPe Domain Sequences for d2egig_:
Sequence, based on SEQRES records: (download)
>d2egig_ d.38.1.0 (G:) automated matches {Aquifex aeolicus [TaxId: 63363]} fiyrrrvqfyetdaqgivhhsnyfryfeeargeflrskgfpyskmrdmglevvllnayce ykkplfyddvfevhlnleelsrftftfsyivfkediavakantkhcmvkngkivsipkev levl
>d2egig_ d.38.1.0 (G:) automated matches {Aquifex aeolicus [TaxId: 63363]} fiyrrrvqfyetdaqgivhhsnyfryfeeargeflrskgfpyskmrdmglevvllnayce ykkplfyddvfevhlnltftfsyivfkediavakantkhcmvkivsipvlevl
Timeline for d2egig_: