![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) ![]() |
![]() | Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
![]() | Protein automated matches [190689] (23 species) not a true protein |
![]() | Species Coffea canephora [TaxId:49390] [188542] (2 PDB entries) |
![]() | Domain d2eg5c_: 2eg5 C: [163992] automated match to d1m6ex_ complexed with sah, xts |
PDB Entry: 2eg5 (more details), 2.2 Å
SCOPe Domain Sequences for d2eg5c_:
Sequence, based on SEQRES records: (download)
>d2eg5c_ c.66.1.0 (C:) automated matches {Coffea canephora [TaxId: 49390]} gdtsyaknsaynqlvlakvkpvleqcvrellranlpninkcikvadlgcasgpntlltvr divqsidkvgqekknelerptiqiflndlfpndfnsvfkllpsfyrklekengrkigscl igampgsfysrlfpeesmhflhscyclqwlsqvpsglvtelgigtnkgsiysskasrlpv qkayldqftkdfttflrihseelfshgrmlltcickgveldarnaidllemaindlvveg hleeekldsfnlpvyipsaeevkciveeegsfeilyletfkvlydagfsiddehikaeyv assvravyepilashfgeaiipdifhrfakhaakvlplgkgfynnliislakkp
>d2eg5c_ c.66.1.0 (C:) automated matches {Coffea canephora [TaxId: 49390]} gdtsyaknsaynqlvlakvkpvleqcvrellranlpninkcikvadlgcasgpntlltvr divqsidkvgqlerptiqiflndlfpndfnsvfkllpsfyrklekengrkigscligamp gsfysrlfpeesmhflhscyclqwlsqvpsglvteligtnkgsiysskasrlpvqkayld qftkdfttflrihseelfshgrmlltcickgveldarnaidllemaindlvveghleeek ldsfnlpvyipsaeevkciveeegsfeilyletfkvlydagfshikaeyvassvravyep ilashfgeaiipdifhrfakhaakvlplgkgfynnliislakkp
Timeline for d2eg5c_: