Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (16 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188355] (9 PDB entries) |
Domain d2efhd_: 2efh D: [163984] automated match to d1r2qa_ complexed with gdp |
PDB Entry: 2efh (more details), 2.1 Å
SCOPe Domain Sequences for d2efhd_:
Sequence, based on SEQRES records: (download)
>d2efhd_ c.37.1.8 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} sinaklvllgdvgagksslvlrfvkdqfvefqestigaaffsqtlavndatvkfeiwdta gqeryhslapmyyrgaaaaiivfdvtnqasferakkwvqelqaqgnpnmvmalagnksdl ldarkvtaedaqtyaqenglffmetsaktatnvkeifyeiarrlp
>d2efhd_ c.37.1.8 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} sinaklvllgdvgagksslvlrfvaaffsqtlavndatvkfeiwdtagqeryhslapmyy rgaaaaiivfdvtnqasferakkwvqelqaqgnpnmvmalagnksdlldarkvtaedaqt yaqenglffmetsaktatnvkeifyeiarrlp
Timeline for d2efhd_: