SCOPe 2.03: Domain d2efhd_: 2efh D:

Lineage for d2efhd_ (2efh D:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (16 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188355] (9 PDB entries)

8. Domain d2efhd_: 2efh D: [163984]
   automated match to d1r2qa_
   complexed with gdp

Details for d2efhd_

PDB Entry: 2efh, 2.1 Å

PDB Description: ara7-gdp/atvps9a(d185n)

PDB Compounds: (D:) Small GTP-binding protein-like

SCOPe Domain Sequences for d2efhd_:

Sequence, based on SEQRES records:

>d2efhd_ c.37.1.8 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sinaklvllgdvgagksslvlrfvkdqfvefqestigaaffsqtlavndatvkfeiwdta
gqeryhslapmyyrgaaaaiivfdvtnqasferakkwvqelqaqgnpnmvmalagnksdl
ldarkvtaedaqtyaqenglffmetsaktatnvkeifyeiarrlp

Sequence, based on observed residues (ATOM records):

>d2efhd_ c.37.1.8 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sinaklvllgdvgagksslvlrfvaaffsqtlavndatvkfeiwdtagqeryhslapmyy
rgaaaaiivfdvtnqasferakkwvqelqaqgnpnmvmalagnksdlldarkvtaedaqt
yaqenglffmetsaktatnvkeifyeiarrlp

Timeline for d2efhd_:

• d2efhd_ first appeared in SCOPe 2.01
  
• d2efhd_ appears in SCOPe 2.02
  
• d2efhd_ appears in SCOPe 2.04
  
• d2efhd_ appears in the current release, SCOPe 2.08