Lineage for d2ef9b_ (2ef9 B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins)
  6. Protein automated matches [190083] (10 species)
    not a true protein
  7. Species Aquifex aeolicus [TaxId:63363] [187662] (1 PDB entry)
  8. Domain d2ef9b_: 2ef9 B: [163978]
    automated match to d1pe1a_
    complexed with a5p, pep

Details for d2ef9b_

PDB Entry: 2ef9 (more details), 2 Å

PDB Description: Structural and mechanistic changes along an engineered path from metallo to non-metallo KDO8P synthase
PDB Compounds: (B:) 2-dehydro-3-deoxyphosphooctonate aldolase

SCOPe Domain Sequences for d2ef9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ef9b_ c.1.10.4 (B:) automated matches {Aquifex aeolicus [TaxId: 63363]}
kflviagmnaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgley
gvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcrqtdlllaaaktgravn
vkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakviyd
athsvqlpgglgdksggmrefifpliraavavgcdgvfmethpepekalsdaptalplsq
legiieaileirevaskyyeti

SCOPe Domain Coordinates for d2ef9b_ are not available.

Timeline for d2ef9b_:

Domains from other chains:
(mouse over for more information)
d2ef9a_