Lineage for d1ab3a_ (1ab3 A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 909017Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 909018Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. 909049Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
    contains additional N-terminal helix that forms a separate unit
  6. 909050Protein Ribosomal protein S15 [47065] (3 species)
  7. 909064Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries)
    Uniprot P80378
  8. 909095Domain d1ab3a_: 1ab3 A: [16395]

Details for d1ab3a_

PDB Entry: 1ab3 (more details)

PDB Description: ribosomal protein s15 from thermus thermophilus, nmr, 26 structures
PDB Compounds: (A:) ribosomal RNA binding protein s15

SCOPe Domain Sequences for d1ab3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ab3a_ a.16.1.2 (A:) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOPe Domain Coordinates for d1ab3a_:

Click to download the PDB-style file with coordinates for d1ab3a_.
(The format of our PDB-style files is described here.)

Timeline for d1ab3a_: