Lineage for d1ab3__ (1ab3 -)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 534943Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 534944Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. 534951Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
    contains additional N-terminal helix that forms a separate unit
  6. 534952Protein Ribosomal protein S15 [47065] (2 species)
  7. 534955Species Thermus thermophilus [TaxId:274] [47067] (23 PDB entries)
  8. 534974Domain d1ab3__: 1ab3 - [16395]

Details for d1ab3__

PDB Entry: 1ab3 (more details)

PDB Description: ribosomal protein s15 from thermus thermophilus, nmr, 26 structures

SCOP Domain Sequences for d1ab3__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ab3__ a.16.1.2 (-) Ribosomal protein S15 {Thermus thermophilus}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOP Domain Coordinates for d1ab3__:

Click to download the PDB-style file with coordinates for d1ab3__.
(The format of our PDB-style files is described here.)

Timeline for d1ab3__: