Lineage for d1ab3__ (1ab3 -)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 278905Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 278906Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. 278913Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
    contains additional N-terminal helix that forms a separate unit
  6. 278914Protein Ribosomal protein S15 [47065] (2 species)
  7. 278917Species Thermus thermophilus [TaxId:274] [47067] (19 PDB entries)
  8. 278935Domain d1ab3__: 1ab3 - [16395]

Details for d1ab3__

PDB Entry: 1ab3 (more details)

PDB Description: ribosomal protein s15 from thermus thermophilus, nmr, 26 structures

SCOP Domain Sequences for d1ab3__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ab3__ a.16.1.2 (-) Ribosomal protein S15 {Thermus thermophilus}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOP Domain Coordinates for d1ab3__:

Click to download the PDB-style file with coordinates for d1ab3__.
(The format of our PDB-style files is described here.)

Timeline for d1ab3__: