Lineage for d1ab3__ (1ab3 -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2004Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
  4. 2005Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. 2012Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
  6. 2013Protein Ribosomal protein S15 [47065] (2 species)
  7. 2016Species Thermus thermophilus [TaxId:274] [47067] (10 PDB entries)
  8. 2027Domain d1ab3__: 1ab3 - [16395]

Details for d1ab3__

PDB Entry: 1ab3 (more details)

PDB Description: ribosomal protein s15 from thermus thermophilus, nmr, 26 structures

SCOP Domain Sequences for d1ab3__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ab3__ a.16.1.2 (-) Ribosomal protein S15 {Thermus thermophilus}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOP Domain Coordinates for d1ab3__:

Click to download the PDB-style file with coordinates for d1ab3__.
(The format of our PDB-style files is described here.)

Timeline for d1ab3__: