Lineage for d2eakc_ (2eak C:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1307103Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1307104Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1308833Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1308834Protein automated matches [190437] (23 species)
    not a true protein
  7. 1308935Species Human (Homo sapiens) [TaxId:9606] [187655] (29 PDB entries)
  8. 1308976Domain d2eakc_: 2eak C: [163922]
    automated match to d1a3ka_
    complexed with dtv, gol, lbt

Details for d2eakc_

PDB Entry: 2eak (more details), 1.97 Å

PDB Description: crystal structure of human galectin-9 n-terminal crd in complex with lactose
PDB Compounds: (C:) Galectin-9

SCOPe Domain Sequences for d2eakc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eakc_ b.29.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiafhfnprf
edggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfvqyfhrv
pfhrvdtisvngsvqlsyisfq

SCOPe Domain Coordinates for d2eakc_:

Click to download the PDB-style file with coordinates for d2eakc_.
(The format of our PDB-style files is described here.)

Timeline for d2eakc_: