Lineage for d2eakb_ (2eak B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051795Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2051796Protein automated matches [190437] (53 species)
    not a true protein
  7. 2052020Species Human (Homo sapiens) [TaxId:9606] [187655] (78 PDB entries)
  8. 2052081Domain d2eakb_: 2eak B: [163921]
    automated match to d1a3ka_
    complexed with dtv, gol, lbt

Details for d2eakb_

PDB Entry: 2eak (more details), 1.97 Å

PDB Description: crystal structure of human galectin-9 n-terminal crd in complex with lactose
PDB Compounds: (B:) Galectin-9

SCOPe Domain Sequences for d2eakb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eakb_ b.29.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiafhfnprf
edggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfvqyfhrv
pfhrvdtisvngsvqlsyisfq

SCOPe Domain Coordinates for d2eakb_:

Click to download the PDB-style file with coordinates for d2eakb_.
(The format of our PDB-style files is described here.)

Timeline for d2eakb_: