SCOP 1.59: Domain d1hnwo_: 1hnw O:

Lineage for d1hnwo_ (1hnw O:)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)

4. Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families)

5. Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)

6. Protein Ribosomal protein S15 [47065] (2 species)

7. Species Thermus thermophilus [TaxId:274] [47067] (14 PDB entries)

8. Domain d1hnwo_: 1hnw O: [16391]
   Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_

Details for d1hnwo_

PDB Entry: 1hnw, 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline

SCOP Domain Sequences for d1hnwo_:

Sequence; same for both SEQRES and ATOM records:

>d1hnwo_ a.16.1.2 (O:) Ribosomal protein S15 {Thermus thermophilus}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

Timeline for d1hnwo_:

• d1hnwo_ first appeared (with stable ids) in SCOP 1.55
  
• d1hnwo_ appears in SCOP 1.57
  
• d1hnwo_ appears in SCOP 1.61
  
• d1hnwo_ appears in the current release, SCOPe 2.08