Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (16 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186842] (99 PDB entries) |
Domain d2e7ld_: 2e7l D: [163896] automated match to d2icwj1 mutant |
PDB Entry: 2e7l (more details), 2.5 Å
SCOPe Domain Sequences for d2e7ld_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e7ld_ b.1.1.1 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} eaavtqsprnkvavtgekvtlscnqtnnhnnmywyrqdtghelrliyysygagstekgdi pdgykasrpsqenfsltlesatpsqtsvyfcasggggtlyfgagtrlsvlss
Timeline for d2e7ld_: