Lineage for d2e7lb_ (2e7l B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1512732Protein automated matches [190119] (19 species)
    not a true protein
  7. 1513189Species Mouse (Mus musculus) [TaxId:10090] [186842] (122 PDB entries)
  8. 1513315Domain d2e7lb_: 2e7l B: [163894]
    automated match to d1i9ea_
    mutant

Details for d2e7lb_

PDB Entry: 2e7l (more details), 2.5 Å

PDB Description: Structure of a high-affinity mutant of the 2C TCR in complex with Ld/QL9
PDB Compounds: (B:) Cytotoxic Tcell receptor

SCOPe Domain Sequences for d2e7lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e7lb_ b.1.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
svtqpdarvtvsegaslqlrckysysatpylfwyvqyprqgpqlllkyysgdpvvqgvng
feaefsksnssfhlrkasvhrsdsavyfcavshqgryltfgsgtkvivlp

SCOPe Domain Coordinates for d2e7lb_:

Click to download the PDB-style file with coordinates for d2e7lb_.
(The format of our PDB-style files is described here.)

Timeline for d2e7lb_: