SCOP 1.61: Domain d1hr0o_: 1hr0 O:

Lineage for d1hr0o_ (1hr0 O:)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)

4. Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families)

5. Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)

6. Protein Ribosomal protein S15 [47065] (2 species)

7. Species Thermus thermophilus [TaxId:274] [47067] (14 PDB entries)

8. Domain d1hr0o_: 1hr0 O: [16389]
   Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0c2, d1hr0d_, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0i_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0p_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_

Details for d1hr0o_

PDB Entry: 1hr0, 3.2 Å

PDB Description: crystal structure of initiation factor if1 bound to the 30s ribosomal subunit

SCOP Domain Sequences for d1hr0o_:

Sequence; same for both SEQRES and ATOM records:

>d1hr0o_ a.16.1.2 (O:) Ribosomal protein S15 {Thermus thermophilus}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

Timeline for d1hr0o_:

• d1hr0o_ first appeared (with stable ids) in SCOP 1.55
  
• d1hr0o_ appears in SCOP 1.59
  
• d1hr0o_ appears in SCOP 1.63
  
• d1hr0o_ appears in the current release, SCOPe 2.08