Class a: All alpha proteins [46456] (284 folds) |
Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) |
Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein) contains additional N-terminal helix that forms a separate unit |
Protein Ribosomal protein S15 [47065] (3 species) |
Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries) Uniprot P80378 |
Domain d1f7ya_: 1f7y A: [16386] complex with an rRNA fragment complexed with k, mg, na |
PDB Entry: 1f7y (more details), 2.8 Å
SCOPe Domain Sequences for d1f7ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f7ya_ a.16.1.2 (A:) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]} pitkeekqkvmqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg qrrrllrylqredperyrmlieklgi
Timeline for d1f7ya_: