SCOP 1.73: Domain d1f7ya_: 1f7y A:

Lineage for d1f7ya_ (1f7y A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families)

5. Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
   contains additional N-terminal helix that forms a separate unit

6. Protein Ribosomal protein S15 [47065] (2 species)

7. Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries)

8. Domain d1f7ya_: 1f7y A: [16386]
   complex with an rRNA fragment
   complexed with k, mg, na

Details for d1f7ya_

PDB Entry: 1f7y, 2.8 Å

PDB Description: the crystal structure of two uucg loops highlights the role played by 2'-hydroxyl groups in its unusual stability

PDB Compounds: (A:) 30S ribosomal protein S15

SCOP Domain Sequences for d1f7ya_:

Sequence; same for both SEQRES and ATOM records:

>d1f7ya_ a.16.1.2 (A:) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]}
pitkeekqkvmqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyrmlieklgi

Timeline for d1f7ya_:

• d1f7ya_ first appeared (with stable ids) in SCOP 1.55
  
• d1f7ya_ appears in SCOP 1.71
  
• d1f7ya_ appears in SCOP 1.75
  
• d1f7ya_ appears in the current release, SCOPe 2.08