Lineage for d1f7ya_ (1f7y A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2004Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
  4. 2005Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. 2012Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
  6. 2013Protein Ribosomal protein S15 [47065] (2 species)
  7. 2016Species Thermus thermophilus [TaxId:274] [47067] (10 PDB entries)
  8. 2020Domain d1f7ya_: 1f7y A: [16386]

Details for d1f7ya_

PDB Entry: 1f7y (more details), 2.8 Å

PDB Description: the crystal structure of two uucg loops highlights the role played by 2'-hydroxyl groups in its unusual stability

SCOP Domain Sequences for d1f7ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f7ya_ a.16.1.2 (A:) Ribosomal protein S15 {Thermus thermophilus}
pitkeekqkvmqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyrmlieklgi

SCOP Domain Coordinates for d1f7ya_:

Click to download the PDB-style file with coordinates for d1f7ya_.
(The format of our PDB-style files is described here.)

Timeline for d1f7ya_: