Lineage for d1f7ya_ (1f7y A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) 
Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein) Protein Ribosomal protein S15 [47065] (2 species) 
Species Thermus thermophilus [TaxId:274] [47067] (10 PDB entries) 
Domain d1f7ya_: 1f7y A: [16386]
Details for d1f7ya_
PDB Entry: 1f7y (more details), 2.8 Å
PDB Description: the crystal structure of two uucg loops highlights the role played by 2'-hydroxyl groups in its unusual stability
SCOP Domain Sequences for d1f7ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f7ya_ a.16.1.2 (A:) Ribosomal protein S15 {Thermus thermophilus}
pitkeekqkvmqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyrmlieklgi
SCOP Domain Coordinates for d1f7ya_:
Click to download the PDB-style file with coordinates for d1f7ya_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f7ya_:
- d1f7ya_ appears in SCOP 1.57
- d1f7ya_ appears in the current release, SCOPe 2.08
View in 3D