SCOPe 2.05: Domain d1dk1a_: 1dk1 A:

Lineage for d1dk1a_ (1dk1 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families)

5. Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
   contains additional N-terminal helix that forms a separate unit
   automatically mapped to Pfam PF00312

6. Protein Ribosomal protein S15 [47065] (3 species)

7. Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries)
   Uniprot P80378

8. Domain d1dk1a_: 1dk1 A: [16385]
   complex with an rRNA fragment
   protein/RNA complex; complexed with k, mg, na

Details for d1dk1a_

PDB Entry: 1dk1, 2.8 Å

PDB Description: detailed view of a key element of the ribosome assembly: crystal structure of the s15-rrna complex

PDB Compounds: (A:) 30S ribosomal protein S15

SCOPe Domain Sequences for d1dk1a_:

Sequence; same for both SEQRES and ATOM records:

>d1dk1a_ a.16.1.2 (A:) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]}
pitkeekqkvmqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyrmlieklgi

Timeline for d1dk1a_:

• d1dk1a_ first appeared (with stable ids) in SCOP 1.55
  
• d1dk1a_ appears in SCOPe 2.04
  
• d1dk1a_ appears in SCOPe 2.06
  
• d1dk1a_ appears in the current release, SCOPe 2.08