Lineage for d2e68b_ (2e68 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2827845Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2827846Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2828301Protein automated matches [190228] (20 species)
    not a true protein
  7. 2828442Species Trypanosoma cruzi [TaxId:5693] [187324] (7 PDB entries)
  8. 2828446Domain d2e68b_: 2e68 B: [163845]
    automated match to d2b4ga1
    complexed with dor, fmn, gol, nco

Details for d2e68b_

PDB Entry: 2e68 (more details), 1.38 Å

PDB Description: Crystal structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with dihydroorotate
PDB Compounds: (B:) dihydroorotate dehydrogenase

SCOPe Domain Sequences for d2e68b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e68b_ c.1.4.1 (B:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
mclklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpeprym
afplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaqe
kgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaaa
vlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyrr
cpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgyr
tleefrgrvktie

SCOPe Domain Coordinates for d2e68b_:

Click to download the PDB-style file with coordinates for d2e68b_.
(The format of our PDB-style files is described here.)

Timeline for d2e68b_: