SCOPe 2.03: Domain d2e5wa_: 2e5w A:

Lineage for d2e5wa_ (2e5w A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.17: Spermidine synthase [69557] (3 proteins)
   contains additional N-terminal tetramerisation all-beta domain, res. 1-71

6. Protein automated matches [190432] (5 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:70601] [187326] (1 PDB entry)

8. Domain d2e5wa_: 2e5w A: [163836]
   automated match to d1mjfa_
   complexed with act, ag3, mta

Details for d2e5wa_

PDB Entry: 2e5w, 2 Å

PDB Description: Crystal structure of spermidine synthase from Pyrococcus horikoshii OT3

PDB Compounds: (A:) Probable spermidine synthase

SCOPe Domain Sequences for d2e5wa_:

Sequence; same for both SEQRES and ATOM records:

>d2e5wa_ c.66.1.17 (A:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
mrdmefiewyprgygvafkvkrkileeqseyqkievyetegfgkllaidgtvqlvtegek
syheplvhpamlahpnprrvliigggdggairevlkheeveevimveidkkvieisakyi
gidggilekmlsdkhekgkliigdgvkfieensgfdviivdstdpvgpaemlfseefykn
ayralndpgiyvtqagsvylftdefltayrkmrkvfdkvyyysfpvigyaspwaflvgvk
gsidfmkvdaekgkklgleyydpdkhetlfqmpryivqml

Timeline for d2e5wa_:

• d2e5wa_ first appeared in SCOPe 2.01
  
• d2e5wa_ appears in SCOPe 2.02
  
• d2e5wa_ appears in SCOPe 2.04
  
• d2e5wa_ appears in the current release, SCOPe 2.08