Lineage for d2e55d_ (2e55 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891861Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2891862Protein automated matches [190891] (38 species)
    not a true protein
  7. 2891879Species Aquifex aeolicus [TaxId:63363] [188297] (1 PDB entry)
  8. 2891883Domain d2e55d_: 2e55 D: [163833]
    automated match to d1o5oa_
    complexed with so4

Details for d2e55d_

PDB Entry: 2e55 (more details), 2.15 Å

PDB Description: Structure of AQ2163 protein from Aquifex aeolicus
PDB Compounds: (D:) uracil phosphoribosyltransferase

SCOPe Domain Sequences for d2e55d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e55d_ c.61.1.0 (D:) automated matches {Aquifex aeolicus [TaxId: 63363]}
mivelshplikhkvntariqdtsaeklrktlkelgfmlvyealkdilleekevrtwignk
rfnylneeeivfvpilraglsflegalqvvpnakvgflgikrneetleshiyysrlpelk
gkivvildpmlatggtlevalreilkhsplkvksvhaiaapeglkrieekfkeveifvgn
vderlndkgyiipglgdigdrlyavsvy

SCOPe Domain Coordinates for d2e55d_:

Click to download the PDB-style file with coordinates for d2e55d_.
(The format of our PDB-style files is described here.)

Timeline for d2e55d_: