Lineage for d2e4qa_ (2e4q A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1782956Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 1782957Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 1782958Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)
  6. 1783038Protein automated matches [190874] (7 species)
    not a true protein
  7. 1783064Species Pseudomonas sp. [TaxId:306] [188227] (3 PDB entries)
  8. 1783065Domain d2e4qa_: 2e4q A: [163826]
    automated match to d1fqta_
    complexed with fes

Details for d2e4qa_

PDB Entry: 2e4q (more details), 1.8 Å

PDB Description: Crystal structure of BphA3 (reduced form)
PDB Compounds: (A:) Biphenyl dioxygenase ferredoxin subunit

SCOPe Domain Sequences for d2e4qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e4qa_ b.33.1.1 (A:) automated matches {Pseudomonas sp. [TaxId: 306]}
tftkacsvdevppgealqvshdaqkvaifnvdgeffatqdqcthgewslseggyldgdvv
ecslhmgkfcvrtgkvkspppceplkvypiriegrdvlvdfsraalha

SCOPe Domain Coordinates for d2e4qa_:

Click to download the PDB-style file with coordinates for d2e4qa_.
(The format of our PDB-style files is described here.)

Timeline for d2e4qa_: