![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
![]() | Superfamily b.33.1: ISP domain [50022] (4 families) ![]() |
![]() | Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins) |
![]() | Protein automated matches [190874] (7 species) not a true protein |
![]() | Species Pseudomonas sp. [TaxId:306] [188227] (3 PDB entries) |
![]() | Domain d2e4pb_: 2e4p B: [163825] automated match to d1fqta_ complexed with fes, so4, tre |
PDB Entry: 2e4p (more details), 2 Å
SCOPe Domain Sequences for d2e4pb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e4pb_ b.33.1.1 (B:) automated matches {Pseudomonas sp. [TaxId: 306]} tftkacsvdevppgealqvshdaqkvaifnvdgeffatqdqcthgewslseggyldgdvv ecslhmgkfcvrtgkvkspppceplkvypiriegrdvlvdfsraalha
Timeline for d2e4pb_: