Lineage for d2e4pb_ (2e4p B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053226Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2053227Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2053228Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)
  6. 2053309Protein automated matches [190874] (7 species)
    not a true protein
  7. 2053337Species Pseudomonas sp. [TaxId:306] [188227] (3 PDB entries)
  8. 2053341Domain d2e4pb_: 2e4p B: [163825]
    automated match to d1fqta_
    complexed with fes, so4, tre

Details for d2e4pb_

PDB Entry: 2e4p (more details), 2 Å

PDB Description: crystal structure of bpha3 (oxidized form)
PDB Compounds: (B:) Biphenyl dioxygenase ferredoxin subunit

SCOPe Domain Sequences for d2e4pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e4pb_ b.33.1.1 (B:) automated matches {Pseudomonas sp. [TaxId: 306]}
tftkacsvdevppgealqvshdaqkvaifnvdgeffatqdqcthgewslseggyldgdvv
ecslhmgkfcvrtgkvkspppceplkvypiriegrdvlvdfsraalha

SCOPe Domain Coordinates for d2e4pb_:

Click to download the PDB-style file with coordinates for d2e4pb_.
(The format of our PDB-style files is described here.)

Timeline for d2e4pb_: