Lineage for d2e2ya_ (2e2y A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688797Species Sperm whale (Physeter catodon) [TaxId:9755] [188226] (7 PDB entries)
  8. 2688798Domain d2e2ya_: 2e2y A: [163807]
    automated match to d1luea_
    complexed with gol, hem, so4

Details for d2e2ya_

PDB Entry: 2e2y (more details), 1.6 Å

PDB Description: crystal structure of f43w/h64d/v68i myoglobin
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d2e2ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e2ya_ a.1.1.2 (A:) automated matches {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekwdrfkhlkteaemkase
dlkkdgvtiltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d2e2ya_:

Click to download the PDB-style file with coordinates for d2e2ya_.
(The format of our PDB-style files is described here.)

Timeline for d2e2ya_: