Lineage for d2dwra_ (2dwr A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1307103Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1307104Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1308833Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1308834Protein automated matches [190437] (23 species)
    not a true protein
  7. 1308989Species Human rotavirus a [TaxId:10941] [187643] (1 PDB entry)
  8. 1308990Domain d2dwra_: 2dwr A: [163730]
    automated match to d1kqra_
    complexed with gol, ipa

Details for d2dwra_

PDB Entry: 2dwr (more details), 2.5 Å

PDB Description: crystal structure of the human wa rotavirus vp8* carbohydrate- recognising domain
PDB Compounds: (A:) Outer capsid protein

SCOPe Domain Sequences for d2dwra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dwra_ b.29.1.0 (A:) automated matches {Human rotavirus a [TaxId: 10941]}
mldgpyqpttftppndywilinsntngvvyestnnsdfwtavvaiephvnpvdrqytifg
eskqfnvsndsnkwkflemfrsssqnefynrrtltsdtrlvgilkyggrvwtfhgetpra
ttdssstanlnnisitihsefyiiprsqeskcneyinngl

SCOPe Domain Coordinates for d2dwra_:

Click to download the PDB-style file with coordinates for d2dwra_.
(The format of our PDB-style files is described here.)

Timeline for d2dwra_: