Class b: All beta proteins [48724] (174 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (13 species) not a true protein |
Species Human rotavirus a [TaxId:10941] [187643] (1 PDB entry) |
Domain d2dwra_: 2dwr A: [163730] automated match to d1kqra_ complexed with gol, ipa |
PDB Entry: 2dwr (more details), 2.5 Å
SCOPe Domain Sequences for d2dwra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dwra_ b.29.1.0 (A:) automated matches {Human rotavirus a [TaxId: 10941]} mldgpyqpttftppndywilinsntngvvyestnnsdfwtavvaiephvnpvdrqytifg eskqfnvsndsnkwkflemfrsssqnefynrrtltsdtrlvgilkyggrvwtfhgetpra ttdssstanlnnisitihsefyiiprsqeskcneyinngl
Timeline for d2dwra_: