Lineage for d1gg3a1 (1gg3 A:82-187)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725169Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1725208Superfamily a.11.2: Second domain of FERM [47031] (2 families) (S)
    automatically mapped to Pfam PF00373
  5. 1725209Family a.11.2.1: Second domain of FERM [47032] (9 proteins)
  6. 1725210Protein Erythroid membrane protein 4.1R [47037] (1 species)
  7. 1725211Species Human (Homo sapiens) [TaxId:9606] [47038] (1 PDB entry)
  8. 1725212Domain d1gg3a1: 1gg3 A:82-187 [16372]
    Other proteins in same PDB: d1gg3a2, d1gg3a3, d1gg3b2, d1gg3b3, d1gg3c2, d1gg3c3

Details for d1gg3a1

PDB Entry: 1gg3 (more details), 2.8 Å

PDB Description: crystal structure of the protein 4.1r membrane binding domain
PDB Compounds: (A:) erythroid membrane protein 4.1r

SCOPe Domain Sequences for d1gg3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gg3a1 a.11.2.1 (A:82-187) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]}
pdpaqlteditryylclqlrqdivagrlpcsfatlallgsytiqselgdydpelhgvdyv
sdfklapnqtkeleekvmelhksyrsmtpaqadleflenakklsmy

SCOPe Domain Coordinates for d1gg3a1:

Click to download the PDB-style file with coordinates for d1gg3a1.
(The format of our PDB-style files is described here.)

Timeline for d1gg3a1: