SCOPe 2.08: Domain d2dumb_: 2dum B:

Lineage for d2dumb_ (2dum B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.0: automated matches [191320] (1 protein)
   not a true family

6. Protein automated matches [190116] (28 species)
   not a true protein

7. Species Pyrococcus horikoshii OT3 [TaxId:70601] [311263] (4 PDB entries)

8. Domain d2dumb_: 2dum B: [163708]
   automated match to d1mjha_

Details for d2dumb_

PDB Entry: 2dum, 2.75 Å

PDB Description: Crystal structure of hypothetical protein, PH0823

PDB Compounds: (B:) Hypothetical protein PH0823

SCOPe Domain Sequences for d2dumb_:

Sequence, based on SEQRES records:

>d2dumb_ c.26.2.0 (B:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
mfrkvlfptdfsegayravevfekrnkmevgevillhvidegtleelmdgysffydnaei
elkdikeklkeeasrklqekaeevkrafraknvrtiirfgipwdeivkvaeeenvsliil
psrgklslsheflgstvmrvlrktkkpvliikevde

Sequence, based on observed residues (ATOM records):

>d2dumb_ c.26.2.0 (B:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
mfrkvlfptdfsegayravevfekrnkmevgevillhvidegtleelmdgykdikeklke
easrklqekaeevkrafraknvrtiirfgipwdeivkvaeeenvsliilpsrheflgstv
mrvlrktkkpvliikevde

Timeline for d2dumb_:

• d2dumb_ first appeared in SCOPe 2.01
  
• d2dumb_ appears in SCOPe 2.07