SCOPe 2.08: Domain d2dtnb_: 2dtn B:

Lineage for d2dtnb_ (2dtn B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156

4. Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families)
   the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase

5. Family c.101.1.0: automated matches [191361] (1 protein)
   not a true family

6. Protein automated matches [190431] (13 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:210] [187325] (2 PDB entries)

8. Domain d2dtnb_: 2dtn B: [163692]
   automated match to d1uehb_
   complexed with dpo

Details for d2dtnb_

PDB Entry: 2dtn, 2.5 Å

PDB Description: Crystal structure of Helicobacter pylori undecaprenyl pyrophosphate synthase complexed with pyrophosphate

PDB Compounds: (B:) undecaprenyl pyrophosphate synthase

SCOPe Domain Sequences for d2dtnb_:

Sequence, based on SEQRES records:

>d2dtnb_ c.101.1.0 (B:) automated matches {Helicobacter pylori [TaxId: 210]}
tlkhlaiimdgngrwaklknkarayghkkgvktlkditiwcanhklecltlyafstenwk
rpksevdflmkmlkkylkderstyldnnirfraigdlegfskelrdtilqlendtrhfkd
ftqvlalnygsknelsrafksllesppsnisllesleneisnrldtrnlpevdlllrtgg
emrlsnfllwqssyaelfftpilwpdftpkdleniisdfykrvrkfge

Sequence, based on observed residues (ATOM records):

>d2dtnb_ c.101.1.0 (B:) automated matches {Helicobacter pylori [TaxId: 210]}
tlkhlaiimdgngrwaklknkarayghkkgvktlkditiwcanhklecltlyamkmlkky
lkderstyldnnirfraigdlegfskelrdtilqlendtrhfkdftqvlalnygsknels
rafksllespleneisnrldtrnlpevdlllrtggemrlsnfllwqssyaelfftpilwp
dftpkdleniisdfykrvrkfge

Timeline for d2dtnb_:

• d2dtnb_ first appeared in SCOPe 2.01
  
• d2dtnb_ appears in SCOPe 2.07