Lineage for d2dgeb_ (2dge B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 904708Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 904709Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 905254Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 905255Protein automated matches [190453] (7 species)
    not a true protein
  7. 905273Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187367] (4 PDB entries)
  8. 905277Domain d2dgeb_: 2dge B: [163628]
    automated match to d1c6sa_
    complexed with hem, zn

Details for d2dgeb_

PDB Entry: 2dge (more details), 1.5 Å

PDB Description: Crystal structure of oxidized cytochrome C6A from Arabidopsis thaliana
PDB Compounds: (B:) cytochrome c6

SCOPe Domain Sequences for d2dgeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dgeb_ a.3.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qtldiqrgatlfnracigchdtggniiqpgatlftkdlerngvdteeeiyrvtyfgkgrm
pgfgekctprgqctfgprlqdeeikllaefvkfqadqgwptv

SCOPe Domain Coordinates for d2dgeb_:

Click to download the PDB-style file with coordinates for d2dgeb_.
(The format of our PDB-style files is described here.)

Timeline for d2dgeb_: