Lineage for d1erca_ (1erc A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637092Fold a.10: Protozoan pheromone-like [47013] (2 superfamilies)
    3 helices; bundle, closed, left-handed twist, up-and-down
  4. 637093Superfamily a.10.1: Protozoan pheromone proteins [47014] (1 family) (S)
  5. 637094Family a.10.1.1: Protozoan pheromone proteins [47015] (5 proteins)
  6. 637095Protein ER-1 [47016] (1 species)
  7. 637096Species Euplotes raikovi [TaxId:5938] [47017] (2 PDB entries)
  8. 637098Domain d1erca_: 1erc A: [16361]

Details for d1erca_

PDB Entry: 1erc (more details)

PDB Description: the nmr solution structure of the pheromone er-1 from the ciliated protozoan euplotes raikovi
PDB Compounds: (A:) pheromone er-1

SCOP Domain Sequences for d1erca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1erca_ a.10.1.1 (A:) ER-1 {Euplotes raikovi [TaxId: 5938]}
daceqaaiqcvesaceslctegedrtgcymyiysncppyv

SCOP Domain Coordinates for d1erca_:

Click to download the PDB-style file with coordinates for d1erca_.
(The format of our PDB-style files is described here.)

Timeline for d1erca_: