Lineage for d2d6mb_ (2d6m B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781809Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1781810Protein automated matches [190437] (37 species)
    not a true protein
  7. 1782081Species Mouse (Mus musculus) [TaxId:10090] [187609] (10 PDB entries)
  8. 1782085Domain d2d6mb_: 2d6m B: [163595]
    automated match to d1a3ka_
    complexed with lbt

Details for d2d6mb_

PDB Entry: 2d6m (more details), 1.6 Å

PDB Description: crystal structure of mouse galectin-9 n-terminal crd in complex with lactose
PDB Compounds: (B:) lectin, galactose binding, soluble 9

SCOPe Domain Sequences for d2d6mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d6mb_ b.29.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gsmalfsaqspyinpiipftgpiqgglqeglqvtlqgttksfaqrfvvnfqnsfngndia
fhfnprfeeggyvvcntkqngqwgpeerkmqmpfqkgmpfelcflvqrsefkvmvnkkff
vqyqhrvpyhlvdtiavsgclklsfitfqtq

SCOPe Domain Coordinates for d2d6mb_:

Click to download the PDB-style file with coordinates for d2d6mb_.
(The format of our PDB-style files is described here.)

Timeline for d2d6mb_: