SCOP 1.75: Domain d2pdea_: 2pde A:

Lineage for d2pdea_ (2pde A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily)
   3 helices; bundle, closed, right-handed twist; up-and-down

4. Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (1 family)

5. Family a.9.1.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47006] (3 proteins)

6. Protein E3/E1 binding domain of dihydrolipoyl acetyltransferase [47011] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [47012] (5 PDB entries)
   Uniprot P11961 118-170
   Uniprot Q8VV74 128-169

8. Domain d2pdea_: 2pde A: [16359]

Details for d2pdea_

PDB Entry: 2pde

PDB Description: the high resolution structure of the peripheral subunit-binding domain of dihydrolipoamide acetyltransferase from the pyruvate dehydrogenase multienzyme complex of bacillus stearothermophilus

PDB Compounds: (A:) dihydrolipoamide acetyltransferase

SCOP Domain Sequences for d2pdea_:

Sequence; same for both SEQRES and ATOM records:

>d2pdea_ a.9.1.1 (A:) E3/E1 binding domain of dihydrolipoyl acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]}
viampsvrkyarekgvdirlvqgtgkngrvlkedidaflagga

Timeline for d2pdea_:

• d2pdea_ first appeared (with stable ids) in SCOP 1.55, called d2pde__
  
• d2pdea_ appears in SCOP 1.73
  
• d2pdea_ appears in SCOPe 2.01
  
• d2pdea_ appears in the current release, SCOPe 2.08