Class a: All alpha proteins [46456] (284 folds) |
Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily) 3 helices; bundle, closed, right-handed twist; up-and-down |
Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (1 family) |
Family a.9.1.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47006] (3 proteins) |
Protein E3/E1 binding domain of dihydrolipoyl acetyltransferase [47011] (1 species) |
Species Bacillus stearothermophilus [TaxId:1422] [47012] (5 PDB entries) Uniprot P11961 118-170 Uniprot Q8VV74 128-169 |
Domain d2pdea_: 2pde A: [16359] |
PDB Entry: 2pde (more details)
SCOP Domain Sequences for d2pdea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pdea_ a.9.1.1 (A:) E3/E1 binding domain of dihydrolipoyl acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} viampsvrkyarekgvdirlvqgtgkngrvlkedidaflagga
Timeline for d2pdea_: