Lineage for d2d5kd_ (2d5k D:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1264121Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1264122Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1265913Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1265914Protein automated matches [190036] (19 species)
    not a true protein
  7. 1266168Species Staphylococcus aureus [TaxId:93062] [187608] (1 PDB entry)
  8. 1266172Domain d2d5kd_: 2d5k D: [163584]
    automated match to d1ji5a_
    complexed with gol

Details for d2d5kd_

PDB Entry: 2d5k (more details), 1.85 Å

PDB Description: crystal structure of dps from staphylococcus aureus
PDB Compounds: (D:) Dps family protein

SCOPe Domain Sequences for d2d5kd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d5kd_ a.25.1.0 (D:) automated matches {Staphylococcus aureus [TaxId: 93062]}
asnqqdvvkelnqqvanwtvaytklhnfhwyvkgpnffslhvkfeelyneasqyvdelae
rilavggnpvgtltecleqsivkeaakgysaeqmveelsqdftniskqlenaieiagnag
ddvsedmfigmqtsvdkhnwmfksyls

SCOPe Domain Coordinates for d2d5kd_:

Click to download the PDB-style file with coordinates for d2d5kd_.
(The format of our PDB-style files is described here.)

Timeline for d2d5kd_: