Lineage for d2d5ka_ (2d5k A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1484437Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1484438Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1486323Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1486324Protein automated matches [190036] (29 species)
    not a true protein
  7. 1486669Species Staphylococcus aureus [TaxId:93062] [187608] (1 PDB entry)
  8. 1486670Domain d2d5ka_: 2d5k A: [163581]
    automated match to d1ji5a_
    complexed with gol

Details for d2d5ka_

PDB Entry: 2d5k (more details), 1.85 Å

PDB Description: crystal structure of dps from staphylococcus aureus
PDB Compounds: (A:) Dps family protein

SCOPe Domain Sequences for d2d5ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d5ka_ a.25.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 93062]}
snqqdvvkelnqqvanwtvaytklhnfhwyvkgpnffslhvkfeelyneasqyvdelaer
ilavggnpvgtltecleqsivkeaakgysaeqmveelsqdftniskqlenaieiagnagd
dvsedmfigmqtsvdkhnwmfksylsle

SCOPe Domain Coordinates for d2d5ka_:

Click to download the PDB-style file with coordinates for d2d5ka_.
(The format of our PDB-style files is described here.)

Timeline for d2d5ka_: