Class a: All alpha proteins [46456] (284 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (19 species) not a true protein |
Species Staphylococcus aureus [TaxId:93062] [187608] (1 PDB entry) |
Domain d2d5ka_: 2d5k A: [163581] automated match to d1ji5a_ complexed with gol |
PDB Entry: 2d5k (more details), 1.85 Å
SCOPe Domain Sequences for d2d5ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d5ka_ a.25.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 93062]} snqqdvvkelnqqvanwtvaytklhnfhwyvkgpnffslhvkfeelyneasqyvdelaer ilavggnpvgtltecleqsivkeaakgysaeqmveelsqdftniskqlenaieiagnagd dvsedmfigmqtsvdkhnwmfksylsle
Timeline for d2d5ka_: