Lineage for d2d4vb_ (2d4v B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905791Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2905792Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2905793Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 2905990Protein automated matches [190072] (22 species)
    not a true protein
  7. 2905991Species Acidithiobacillus thiooxidans [TaxId:930] [187607] (1 PDB entry)
  8. 2905993Domain d2d4vb_: 2d4v B: [163578]
    automated match to d1isoa_
    complexed with flc, nad

Details for d2d4vb_

PDB Entry: 2d4v (more details), 1.9 Å

PDB Description: Crystal structure of NAD dependent isocitrate dehydrogenase from Acidithiobacillus thiooxidans
PDB Compounds: (B:) isocitrate dehydrogenase

SCOPe Domain Sequences for d2d4vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d4vb_ c.77.1.1 (B:) automated matches {Acidithiobacillus thiooxidans [TaxId: 930]}
thiqkpatgspltllngvlqvpdqpiipfiegdgigcdvtpamrsvvdaavakvyggqrq
iawmelfagqkavqlygegqylpdetmaaireykvaikgpletpvgggirslnvamrqdl
dlyvclrpvryfegtpspmrhpekvdmvifrensediyagiewpagspeaekiirflree
mgvtkirfpdssaigikpvstegserlirrtiqyalehgkpsvslvhkgnimkfteggfr
dwgyalaerefagrvftwrqkaaiskaegkaagqkaeqqaiadgkliikdviadnflqqi
llrpedysvvatlnlngdyvsdalaaevggigmapganlsdthaifeathgtapdiagqg
kanpsslilsavmmlehlgwgeaaqaivaamnatiaagevtgdlaalrgdvpalstteft
aalirrf

SCOPe Domain Coordinates for d2d4vb_:

Click to download the PDB-style file with coordinates for d2d4vb_.
(The format of our PDB-style files is described here.)

Timeline for d2d4vb_: