Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) the constituent families form similar dimers |
Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins) the active site is between the two identical subunits |
Protein automated matches [190072] (22 species) not a true protein |
Species Acidithiobacillus thiooxidans [TaxId:930] [187607] (1 PDB entry) |
Domain d2d4vb_: 2d4v B: [163578] automated match to d1isoa_ complexed with flc, nad |
PDB Entry: 2d4v (more details), 1.9 Å
SCOPe Domain Sequences for d2d4vb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d4vb_ c.77.1.1 (B:) automated matches {Acidithiobacillus thiooxidans [TaxId: 930]} thiqkpatgspltllngvlqvpdqpiipfiegdgigcdvtpamrsvvdaavakvyggqrq iawmelfagqkavqlygegqylpdetmaaireykvaikgpletpvgggirslnvamrqdl dlyvclrpvryfegtpspmrhpekvdmvifrensediyagiewpagspeaekiirflree mgvtkirfpdssaigikpvstegserlirrtiqyalehgkpsvslvhkgnimkfteggfr dwgyalaerefagrvftwrqkaaiskaegkaagqkaeqqaiadgkliikdviadnflqqi llrpedysvvatlnlngdyvsdalaaevggigmapganlsdthaifeathgtapdiagqg kanpsslilsavmmlehlgwgeaaqaivaamnatiaagevtgdlaalrgdvpalstteft aalirrf
Timeline for d2d4vb_: