SCOPe 2.05: Domain d2d4da_: 2d4d A:

Lineage for d2d4da_ (2d4d A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)

8. Domain d2d4da_: 2d4d A: [163576]
   automated match to d1a9bb_
   complexed with na; mutant

Details for d2d4da_

PDB Entry: 2d4d, 2.1 Å

PDB Description: the crystal structure of human beta2-microglobulin, l39w w60f w95f mutant

PDB Compounds: (A:) Beta-2-microglobulin

SCOPe Domain Sequences for d2d4da_:

Sequence; same for both SEQRES and ATOM records:

>d2d4da_ b.1.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdwlkngeriekvehsdlsfskd
fsfyllyyteftptekdeyacrvnhvtlsqpkivkf

Timeline for d2d4da_:

• d2d4da_ first appeared in SCOPe 2.01
  
• d2d4da_ appears in SCOPe 2.04
  
• d2d4da_ is called d2d4da1 in SCOPe 2.06
  
• d2d4da_ appears in the current release, SCOPe 2.08, called d2d4da1