Lineage for d2d4da_ (2d4d A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517240Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)
  8. 1517409Domain d2d4da_: 2d4d A: [163576]
    automated match to d1a9bb_
    complexed with na; mutant

Details for d2d4da_

PDB Entry: 2d4d (more details), 2.1 Å

PDB Description: The Crystal Structure of human beta2-microglobulin, L39W W60F W95F Mutant
PDB Compounds: (A:) Beta-2-microglobulin

SCOPe Domain Sequences for d2d4da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d4da_ b.1.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdwlkngeriekvehsdlsfskd
fsfyllyyteftptekdeyacrvnhvtlsqpkivkf

SCOPe Domain Coordinates for d2d4da_:

Click to download the PDB-style file with coordinates for d2d4da_.
(The format of our PDB-style files is described here.)

Timeline for d2d4da_: