Lineage for d2d48a_ (2d48 A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1266371Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1266372Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1266458Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 1266592Protein automated matches [190501] (2 species)
    not a true protein
  7. 1266593Species Human (Homo sapiens) [TaxId:9606] [187448] (11 PDB entries)
  8. 1266594Domain d2d48a_: 2d48 A: [163575]
    automated match to d1itla_
    complexed with so4

Details for d2d48a_

PDB Entry: 2d48 (more details), 1.65 Å

PDB Description: crystal structure of the interleukin-4 variant t13d
PDB Compounds: (A:) interleukin-4

SCOPe Domain Sequences for d2d48a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d48a_ a.26.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hkcditlqeiikdlnslteqktlcteltvtdifaaskntteketfcraatvlrqfyshhe
kdtrclgataqqfhrhkqlirflkrldrnlwglaglnscpvkeanqstlenflerlktim
rekyskcss

SCOPe Domain Coordinates for d2d48a_:

Click to download the PDB-style file with coordinates for d2d48a_.
(The format of our PDB-style files is described here.)

Timeline for d2d48a_: