Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
Protein automated matches [190590] (12 species) not a true protein |
Species Oligobrachia mashikoi [TaxId:55676] [187601] (4 PDB entries) |
Domain d2d2mb_: 2d2m B: [163560] automated match to d1x9fb_ complexed with hem, oxy |
PDB Entry: 2d2m (more details), 2.85 Å
SCOPe Domain Sequences for d2d2mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d2mb_ a.1.1.0 (B:) automated matches {Oligobrachia mashikoi [TaxId: 55676]} dctslnrllvkrqwaeaygegtnrellgnriwedlfanmpdarglfsrvngndidssefq ahslrvlggldmcvaslddvpvlnallarlnsqhdsrgipaagypafvasaisavratvg arsfdndawnscmnqivsgisg
Timeline for d2d2mb_: