SCOPe 2.05: Domain d2d1xc_: 2d1x C:

Lineage for d2d1xc_ (2d1x C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187598] (88 PDB entries)

8. Domain d2d1xc_: 2d1x C: [163555]
   automated match to d1jo8a_
   complexed with so4

Details for d2d1xc_

PDB Entry: 2d1x, 1.9 Å

PDB Description: The crystal structure of the cortactin-SH3 domain and AMAP1-peptide complex

PDB Compounds: (C:) cortactin isoform a

SCOPe Domain Sequences for d2d1xc_:

Sequence; same for both SEQRES and ATOM records:

>d2d1xc_ b.34.2.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gplgsendlgitavalydyqaagddeisfdpddiitniemiddgwwrgvckgryglfpan
yvelrq

Timeline for d2d1xc_:

• d2d1xc_ first appeared in SCOPe 2.01
  
• d2d1xc_ appears in SCOPe 2.04
  
• d2d1xc_ is called d2d1xc1 in SCOPe 2.06
  
• d2d1xc_ appears in the current release, SCOPe 2.08, called d2d1xc1