Lineage for d2d1ra_ (2d1r A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2573817Fold e.23: Acetyl-CoA synthetase-like [56800] (1 superfamily)
    4 domains: (1&2) duplication: share the same alpha/beta fold; (3) beta-barrel; (4) alpha+beta
  4. 2573818Superfamily e.23.1: Acetyl-CoA synthetase-like [56801] (2 families) (S)
  5. 2573819Family e.23.1.1: Acetyl-CoA synthetase-like [56802] (7 proteins)
  6. 2573870Protein Luciferase [56803] (2 species)
  7. 2573878Species Luciola cruciata [TaxId:7051] [187597] (4 PDB entries)
  8. 2573881Domain d2d1ra_: 2d1r A: [163550]
    automated match to d1ba3a_
    complexed with amp, olu

Details for d2d1ra_

PDB Entry: 2d1r (more details), 1.6 Å

PDB Description: crystal structure of the thermostable japanese firefly luciferase complexed with oxyluciferin and amp
PDB Compounds: (A:) Luciferin 4-monooxygenase

SCOPe Domain Sequences for d2d1ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d1ra_ e.23.1.1 (A:) Luciferase {Luciola cruciata [TaxId: 7051]}
denivvgpkpfypieegsagtqlrkymeryaklgaiaftnavtgvdysyaeylekscclg
kalqnyglvvdgrialcsenceeffipviaglfigvgvaptneiytlrelvhslgiskpt
ivfsskkgldkvitvqktvttiktivildskvdyrgyqcldtfikrntppgfqassfktv
evdrkeqvalimnssgstglpkgvqlthenivtrfshardpiygnqvspgtavltvvpfh
hgfgmfttlgylicgfrvvmltkfdeetflktlqdykctsvilvptlfailnksellnky
dlsnlveiasggaplskevgeavarrfnlpgvrqgygltettsaiiitpegddkpgasgk
vvplfkakvidldtkkslgpnrrgevcvkgpmlmkgyvnnpeatkelideegwlhtgdig
yydeekhffivdrlkslikykgyqvppaelesvllqhpsifdagvagvpdpvagelpgav
vvlesgknmtekevmdyvasqvsnakrlrggvrfvdevpkgltgkidgraireilkkpv

SCOPe Domain Coordinates for d2d1ra_:

Click to download the PDB-style file with coordinates for d2d1ra_.
(The format of our PDB-style files is described here.)

Timeline for d2d1ra_: