| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
| Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
| Protein automated matches [190453] (7 species) not a true protein |
| Species Hyphomicrobium denitrificans [TaxId:53399] [187593] (1 PDB entry) |
| Domain d2d0wb_: 2d0w B: [163544] automated match to d2c8sa1 complexed with hem, zn |
PDB Entry: 2d0w (more details), 1.98 Å
SCOPe Domain Sequences for d2d0wb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d0wb_ a.3.1.0 (B:) automated matches {Hyphomicrobium denitrificans [TaxId: 53399]}
aqevfrntvtgealdvegqapkegrdtpavkqfmqtgvdpyvevagclpkgeeiylescs
gchghigegkvgpglndsywtypknttdkglfetifggangmmgphgqdleldnmlklia
wirhiqkddvadadwlsdeqkknfkpfdikaweatgkaaaekaqckis
Timeline for d2d0wb_: