SCOPe 2.01: Domain d2d0wa_: 2d0w A:

Lineage for d2d0wa_ (2d0w A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.0: automated matches [191374] (1 protein)
   not a true family

6. Protein automated matches [190453] (7 species)
   not a true protein

7. Species Hyphomicrobium denitrificans [TaxId:53399] [187593] (1 PDB entry)

8. Domain d2d0wa_: 2d0w A: [163543]
   automated match to d2c8sa1
   complexed with hem, zn

Details for d2d0wa_

PDB Entry: 2d0w, 1.98 Å

PDB Description: Crystal structure of cytochrome cL from Hyphomicrobium denitrificans

PDB Compounds: (A:) cytochrome cL

SCOPe Domain Sequences for d2d0wa_:

Sequence; same for both SEQRES and ATOM records:

>d2d0wa_ a.3.1.0 (A:) automated matches {Hyphomicrobium denitrificans [TaxId: 53399]}
aqevfrntvtgealdvegqapkegrdtpavkqfmqtgvdpyvevagclpkgeeiylescs
gchghigegkvgpglndsywtypknttdkglfetifggangmmgphgqdleldnmlklia
wirhiqkddvadadwlsdeqkknfkpfdikaweatgkaaaekaqckis

Timeline for d2d0wa_:

• d2d0wa_ is new in SCOPe 2.01-stable
  
• d2d0wa_ appears in SCOPe 2.02
  
• d2d0wa_ appears in the current release, SCOPe 2.08